Anti FAM217B pAb (ATL-HPA041021)

Atlas Antibodies

SKU:
ATL-HPA041021-25
  • Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 217, member B
Gene Name: FAM217B
Alternative Gene Name: C20orf177, dJ551D2.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070476: 53%, ENSRNOG00000053607: 43%
Entrez Gene ID: 63939
Uniprot ID: Q9NTX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSKSTKLQRWDLSGSGSSSKVETSGHIRVPKQAAVILDSADSCKASKTQAHAHPRKKGKAESCGHATVSSEKKLKTNGVKQ
Gene Sequence SSKSTKLQRWDLSGSGSSSKVETSGHIRVPKQAAVILDSADSCKASKTQAHAHPRKKGKAESCGHATVSSEKKLKTNGVKQ
Gene ID - Mouse ENSMUSG00000070476
Gene ID - Rat ENSRNOG00000053607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM217B pAb (ATL-HPA041021)
Datasheet Anti FAM217B pAb (ATL-HPA041021) Datasheet (External Link)
Vendor Page Anti FAM217B pAb (ATL-HPA041021) at Atlas Antibodies

Documents & Links for Anti FAM217B pAb (ATL-HPA041021)
Datasheet Anti FAM217B pAb (ATL-HPA041021) Datasheet (External Link)
Vendor Page Anti FAM217B pAb (ATL-HPA041021)