Anti FAM217B pAb (ATL-HPA041021)

Atlas Antibodies

Catalog No.: ATL-HPA041021-25

Protein Description: family with sequence similarity 217, member B
Gene Name: FAM217B
Alternative Gene Name: C20orf177, dJ551D2.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070476: 53%, ENSRNOG00000053607: 43%
Entrez Gene ID: 63939
Uniprot ID: Q9NTX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSKSTKLQRWDLSGSGSSSKVETSGHIRVPKQAAVILDSADSCKASKTQAHAHPRKKGKAESCGHATVSSEKKLKTNGVKQ
• Gene Sequence: SSKSTKLQRWDLSGSGSSSKVETSGHIRVPKQAAVILDSADSCKASKTQAHAHPRKKGKAESCGHATVSSEKKLKTNGVKQ
• Gene ID - Mouse: ENSMUSG00000070476
• Gene ID - Rat: ENSRNOG00000053607
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.