Anti FAM217A pAb (ATL-HPA035455)

Atlas Antibodies

SKU:
ATL-HPA035455-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in seminiferous duct cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 217, member A
Gene Name: FAM217A
Alternative Gene Name: C6orf146, MGC43581
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021414: 73%, ENSRNOG00000016672: 70%
Entrez Gene ID: 222826
Uniprot ID: Q8IXS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVDKQVGPYPGLPMPLGLCWPYADGDFFKNRNEIHVSSCSTIENNDGETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKPETIK
Gene Sequence SVDKQVGPYPGLPMPLGLCWPYADGDFFKNRNEIHVSSCSTIENNDGETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKPETIK
Gene ID - Mouse ENSMUSG00000021414
Gene ID - Rat ENSRNOG00000016672
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM217A pAb (ATL-HPA035455)
Datasheet Anti FAM217A pAb (ATL-HPA035455) Datasheet (External Link)
Vendor Page Anti FAM217A pAb (ATL-HPA035455) at Atlas Antibodies

Documents & Links for Anti FAM217A pAb (ATL-HPA035455)
Datasheet Anti FAM217A pAb (ATL-HPA035455) Datasheet (External Link)
Vendor Page Anti FAM217A pAb (ATL-HPA035455)