Anti FAM216B pAb (ATL-HPA040118)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040118-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FAM216B
Alternative Gene Name: C13orf30, FLJ40919
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045655: 66%, ENSRNOG00000021943: 70%
Entrez Gene ID: 144809
Uniprot ID: Q8N7L0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRK |
Gene Sequence | NWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRK |
Gene ID - Mouse | ENSMUSG00000045655 |
Gene ID - Rat | ENSRNOG00000021943 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM216B pAb (ATL-HPA040118) | |
Datasheet | Anti FAM216B pAb (ATL-HPA040118) Datasheet (External Link) |
Vendor Page | Anti FAM216B pAb (ATL-HPA040118) at Atlas Antibodies |
Documents & Links for Anti FAM216B pAb (ATL-HPA040118) | |
Datasheet | Anti FAM216B pAb (ATL-HPA040118) Datasheet (External Link) |
Vendor Page | Anti FAM216B pAb (ATL-HPA040118) |