Anti FAM216B pAb (ATL-HPA040118)

Atlas Antibodies

Catalog No.:
ATL-HPA040118-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 216, member B
Gene Name: FAM216B
Alternative Gene Name: C13orf30, FLJ40919
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045655: 66%, ENSRNOG00000021943: 70%
Entrez Gene ID: 144809
Uniprot ID: Q8N7L0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRK
Gene Sequence NWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRK
Gene ID - Mouse ENSMUSG00000045655
Gene ID - Rat ENSRNOG00000021943
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM216B pAb (ATL-HPA040118)
Datasheet Anti FAM216B pAb (ATL-HPA040118) Datasheet (External Link)
Vendor Page Anti FAM216B pAb (ATL-HPA040118) at Atlas Antibodies

Documents & Links for Anti FAM216B pAb (ATL-HPA040118)
Datasheet Anti FAM216B pAb (ATL-HPA040118) Datasheet (External Link)
Vendor Page Anti FAM216B pAb (ATL-HPA040118)