Anti FAM214A pAb (ATL-HPA040180)

Atlas Antibodies

SKU:
ATL-HPA040180-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 214, member A
Gene Name: FAM214A
Alternative Gene Name: FLJ10980, KIAA1370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034858: 88%, ENSRNOG00000058522: 87%
Entrez Gene ID: 56204
Uniprot ID: Q32MH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVLRTTLKHSNVWRKHNFHSLDGTSTRAFHPQTGLPLLSSPVPQRKTQSGCFDLDSSLLHLKSFSSRSPRPCLNIEDDPDIHEKPFLSSSAPPI
Gene Sequence EVLRTTLKHSNVWRKHNFHSLDGTSTRAFHPQTGLPLLSSPVPQRKTQSGCFDLDSSLLHLKSFSSRSPRPCLNIEDDPDIHEKPFLSSSAPPI
Gene ID - Mouse ENSMUSG00000034858
Gene ID - Rat ENSRNOG00000058522
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM214A pAb (ATL-HPA040180)
Datasheet Anti FAM214A pAb (ATL-HPA040180) Datasheet (External Link)
Vendor Page Anti FAM214A pAb (ATL-HPA040180) at Atlas Antibodies

Documents & Links for Anti FAM214A pAb (ATL-HPA040180)
Datasheet Anti FAM214A pAb (ATL-HPA040180) Datasheet (External Link)
Vendor Page Anti FAM214A pAb (ATL-HPA040180)