Anti FAM214A pAb (ATL-HPA039369)

Atlas Antibodies

SKU:
ATL-HPA039369-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 214, member A
Gene Name: FAM214A
Alternative Gene Name: FLJ10980, KIAA1370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034858: 67%, ENSRNOG00000058522: 64%
Entrez Gene ID: 56204
Uniprot ID: Q32MH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNEGKIRLKPETPRSETCISNDFYSHMPVGETNPLIGSLLQERQDVIARIAQHLEHIDPTASHIPRQSFNMHDSSSVASKVFRSSYEDKNLLKKNKDESSVSISHT
Gene Sequence TNEGKIRLKPETPRSETCISNDFYSHMPVGETNPLIGSLLQERQDVIARIAQHLEHIDPTASHIPRQSFNMHDSSSVASKVFRSSYEDKNLLKKNKDESSVSISHT
Gene ID - Mouse ENSMUSG00000034858
Gene ID - Rat ENSRNOG00000058522
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM214A pAb (ATL-HPA039369)
Datasheet Anti FAM214A pAb (ATL-HPA039369) Datasheet (External Link)
Vendor Page Anti FAM214A pAb (ATL-HPA039369) at Atlas Antibodies

Documents & Links for Anti FAM214A pAb (ATL-HPA039369)
Datasheet Anti FAM214A pAb (ATL-HPA039369) Datasheet (External Link)
Vendor Page Anti FAM214A pAb (ATL-HPA039369)



Citations for Anti FAM214A pAb (ATL-HPA039369) – 1 Found
Hilsabeck, Tyler A U; Liu-Bryan, Ru; Guo, Tracy; Wilson, Kenneth A; Bose, Neelanjan; Raftery, Daniel; Beck, Jennifer N; Lang, Sven; Jin, Kelly; Nelson, Christopher S; Oron, Tal; Stoller, Marshall; Promislow, Daniel; Brem, Rachel B; Terkeltaub, Robert; Kapahi, Pankaj. A fly GWAS for purine metabolites identifies human FAM214 homolog medusa, which acts in a conserved manner to enhance hyperuricemia-driven pathologies by modulating purine metabolism and the inflammatory response. Geroscience. 2022;44(4):2195-2211.  PubMed