Anti FAM213A pAb (ATL-HPA024565 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024565-100
  • Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in adipocytes.
  • Western blot analysis in human cell lines SK-MEL-30 and PC-3 using Anti-FAM213A antibody. Corresponding FAM213A RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 213, member A
Gene Name: FAM213A
Alternative Gene Name: C10orf58, MGC4248, PAMM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021792: 87%, ENSRNOG00000011140: 83%
Entrez Gene ID: 84293
Uniprot ID: Q9BRX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK
Gene Sequence KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK
Gene ID - Mouse ENSMUSG00000021792
Gene ID - Rat ENSRNOG00000011140
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM213A pAb (ATL-HPA024565 w/enhanced validation)
Datasheet Anti FAM213A pAb (ATL-HPA024565 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM213A pAb (ATL-HPA024565 w/enhanced validation)



Citations for Anti FAM213A pAb (ATL-HPA024565 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed