Anti FAM212B pAb (ATL-HPA027809)

Atlas Antibodies

Catalog No.: ATL-HPA027809-25

Protein Description: family with sequence similarity 212, member B
Gene Name: FAM212B
Alternative Gene Name: C1orf183, FLJ31105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048458: 82%, ENSRNOG00000015691: 81%
Entrez Gene ID: 55924
Uniprot ID: Q9NTI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTMESREMDCYLRRLKQELMSMKEVGDGLQDQMNCMMGALQELKLLQVQTALEQLEISGGGPVPGSPEGPRTQC
• Gene Sequence: MTMESREMDCYLRRLKQELMSMKEVGDGLQDQMNCMMGALQELKLLQVQTALEQLEISGGGPVPGSPEGPRTQC
• Gene ID - Mouse: ENSMUSG00000048458
• Gene ID - Rat: ENSRNOG00000015691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM212B pAb (ATL-HPA027809) – 1 Found

Chen, Guang-Liang; Li, Rui; Chen, Xiao-Xiang; Wang, Juan; Cao, Shan; Song, Rui; Zhao, Ming-Chun; Li, Li-Ming; Hannemmann, Nicole; Schett, Georg; Qian, Cheng; Bozec, Aline. Fra-2/AP-1 regulates melanoma cell metastasis by downregulating Fam212b. Cell Death And Differentiation. 2021;28(4):1364-1378.