Anti FAM210A pAb (ATL-HPA014324 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA014324-25
  • Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in glial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
  • Western blot analysis in human cell lines U2OS and HeLa using Anti-FAM210A antibody. Corresponding FAM210A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 210, member A
Gene Name: FAM210A
Alternative Gene Name: C18orf19, HsT2329, MGC24180
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038121: 91%, ENSRNOG00000016740: 91%
Entrez Gene ID: 125228
Uniprot ID: Q96ND0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKE
Gene Sequence ALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKE
Gene ID - Mouse ENSMUSG00000038121
Gene ID - Rat ENSRNOG00000016740
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM210A pAb (ATL-HPA014324 w/enhanced validation)
Datasheet Anti FAM210A pAb (ATL-HPA014324 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM210A pAb (ATL-HPA014324 w/enhanced validation)