Anti FAM20C pAb (ATL-HPA019823)

Atlas Antibodies

SKU: ATL-HPA019823-25

• 

Protein Description: family with sequence similarity 20, member C
Gene Name: FAM20C
Alternative Gene Name: DKFZp547D065, DMP4, IMAGE:4942737
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025854: 87%, ENSRNOG00000001314: 87%
Entrez Gene ID: 56975
Uniprot ID: Q8IXL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIM
• Gene Sequence: VNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIM
• Gene ID - Mouse: ENSMUSG00000025854
• Gene ID - Rat: ENSRNOG00000001314
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM20C pAb (ATL-HPA019823) – 1 Found

Wang, Shih-Kai; Samann, Andrew C; Hu, Jan C-C; Simmer, James P. FAM20C functions intracellularly within both ameloblasts and odontoblasts in vivo. Journal Of Bone And Mineral Research : The Official Journal Of The American Society For Bone And Mineral Research. 2013;28(12):2508-11.