Anti FAM208B pAb (ATL-HPA038043)

Atlas Antibodies

SKU:
ATL-HPA038043-25
  • Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 208, member B
Gene Name: FAM208B
Alternative Gene Name: bA318E3.2, C10orf18, FLJ20360, KIAA2006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033799: 51%, ENSRNOG00000018011: 55%
Entrez Gene ID: 54906
Uniprot ID: Q5VWN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGTVTQATFTRTYDGPGSQPVICQSSVYGTLENKVDILDAAVQTKTGTLQDLIQHGSPINNECHPSLERKDDNMGCAVINPEPITLTFEKNAHVPIQTEGVNTADER
Gene Sequence SGTVTQATFTRTYDGPGSQPVICQSSVYGTLENKVDILDAAVQTKTGTLQDLIQHGSPINNECHPSLERKDDNMGCAVINPEPITLTFEKNAHVPIQTEGVNTADER
Gene ID - Mouse ENSMUSG00000033799
Gene ID - Rat ENSRNOG00000018011
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM208B pAb (ATL-HPA038043)
Datasheet Anti FAM208B pAb (ATL-HPA038043) Datasheet (External Link)
Vendor Page Anti FAM208B pAb (ATL-HPA038043) at Atlas Antibodies

Documents & Links for Anti FAM208B pAb (ATL-HPA038043)
Datasheet Anti FAM208B pAb (ATL-HPA038043) Datasheet (External Link)
Vendor Page Anti FAM208B pAb (ATL-HPA038043)