Anti FAM193B pAb (ATL-HPA035848)

Atlas Antibodies

SKU:
ATL-HPA035848-25
  • Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 193, member B
Gene Name: FAM193B
Alternative Gene Name: FLJ10404, KIAA1931
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021495: 89%, ENSRNOG00000039807: 87%
Entrez Gene ID: 54540
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSTEPKVPNSARAAKRARHKLKKKEKEKAQLAAEALKQANRVSGSREPRPARERLLEWPDRELDRVNSFLSSRLQEIKNTVKDSIRASFSVCE
Gene Sequence NSTEPKVPNSARAAKRARHKLKKKEKEKAQLAAEALKQANRVSGSREPRPARERLLEWPDRELDRVNSFLSSRLQEIKNTVKDSIRASFSVCE
Gene ID - Mouse ENSMUSG00000021495
Gene ID - Rat ENSRNOG00000039807
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM193B pAb (ATL-HPA035848)
Datasheet Anti FAM193B pAb (ATL-HPA035848) Datasheet (External Link)
Vendor Page Anti FAM193B pAb (ATL-HPA035848) at Atlas Antibodies

Documents & Links for Anti FAM193B pAb (ATL-HPA035848)
Datasheet Anti FAM193B pAb (ATL-HPA035848) Datasheet (External Link)
Vendor Page Anti FAM193B pAb (ATL-HPA035848)