Anti FAM193A pAb (ATL-HPA043116)

Atlas Antibodies

SKU: ATL-HPA043116-25

• 
• 

Protein Description: family with sequence similarity 193, member A
Gene Name: FAM193A
Alternative Gene Name: C4orf8, RES4-22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037210: 97%, ENSRNOG00000013832: 97%
Entrez Gene ID: 8603
Uniprot ID: P78312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSISTFLGTLENEHLKKFQVTWELHNKHLFENLVFSEPLLQSNLPALVSQIRLGTTTHDTCSEDTYSTLLQRYQRSEEELRRVAEEWLECQKRIDAYVDEQM
• Gene Sequence: RSISTFLGTLENEHLKKFQVTWELHNKHLFENLVFSEPLLQSNLPALVSQIRLGTTTHDTCSEDTYSTLLQRYQRSEEELRRVAEEWLECQKRIDAYVDEQM
• Gene ID - Mouse: ENSMUSG00000037210
• Gene ID - Rat: ENSRNOG00000013832
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.