Anti FAM185A pAb (ATL-HPA020470 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA020470-25
  • Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM185A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY428775).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 185, member A
Gene Name: FAM185A
Alternative Gene Name: MGC35361
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047221: 81%, ENSRNOG00000048371: 77%
Entrez Gene ID: 222234
Uniprot ID: Q8N0U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTLKEWTLQVSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGGVRGLDGLQVKYDEDLEEMAIVSDTIHPQASVEV
Gene Sequence RTLKEWTLQVSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGGVRGLDGLQVKYDEDLEEMAIVSDTIHPQASVEV
Gene ID - Mouse ENSMUSG00000047221
Gene ID - Rat ENSRNOG00000048371
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM185A pAb (ATL-HPA020470 w/enhanced validation)
Datasheet Anti FAM185A pAb (ATL-HPA020470 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM185A pAb (ATL-HPA020470 w/enhanced validation)