Anti FAM183A pAb (ATL-HPA043382)

Atlas Antibodies

Catalog No.: ATL-HPA043382-25

Protein Description: family with sequence similarity 183, member A
Gene Name: FAM183A
Alternative Gene Name: hCG23177, LOC440585
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049154: 90%, ENSRNOG00000002873: 87%
Entrez Gene ID: 440585
Uniprot ID: A6NL82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEVHQNQILRELYLKELRTQKLHTQYHVNP
• Gene Sequence: DEVHQNQILRELYLKELRTQKLHTQYHVNP
• Gene ID - Mouse: ENSMUSG00000049154
• Gene ID - Rat: ENSRNOG00000002873
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.