Anti FAM183A pAb (ATL-HPA043382)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043382-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FAM183A
Alternative Gene Name: hCG23177, LOC440585
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049154: 90%, ENSRNOG00000002873: 87%
Entrez Gene ID: 440585
Uniprot ID: A6NL82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEVHQNQILRELYLKELRTQKLHTQYHVNP |
Gene Sequence | DEVHQNQILRELYLKELRTQKLHTQYHVNP |
Gene ID - Mouse | ENSMUSG00000049154 |
Gene ID - Rat | ENSRNOG00000002873 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM183A pAb (ATL-HPA043382) | |
Datasheet | Anti FAM183A pAb (ATL-HPA043382) Datasheet (External Link) |
Vendor Page | Anti FAM183A pAb (ATL-HPA043382) at Atlas Antibodies |
Documents & Links for Anti FAM183A pAb (ATL-HPA043382) | |
Datasheet | Anti FAM183A pAb (ATL-HPA043382) Datasheet (External Link) |
Vendor Page | Anti FAM183A pAb (ATL-HPA043382) |