Anti FAM180A pAb (ATL-HPA021224)

Atlas Antibodies

SKU: ATL-HPA021224-25

• 

Protein Description: family with sequence similarity 180, member A
Gene Name: FAM180A
Alternative Gene Name: HWKM1940, UNQ1940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047420: 83%, ENSRNOG00000011750: 83%
Entrez Gene ID: 389558
Uniprot ID: Q6UWF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNN
• Gene Sequence: MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNN
• Gene ID - Mouse: ENSMUSG00000047420
• Gene ID - Rat: ENSRNOG00000011750
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.