Anti FAM180A pAb (ATL-HPA021224)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021224-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FAM180A
Alternative Gene Name: HWKM1940, UNQ1940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047420: 83%, ENSRNOG00000011750: 83%
Entrez Gene ID: 389558
Uniprot ID: Q6UWF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNN |
Gene Sequence | MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNN |
Gene ID - Mouse | ENSMUSG00000047420 |
Gene ID - Rat | ENSRNOG00000011750 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM180A pAb (ATL-HPA021224) | |
Datasheet | Anti FAM180A pAb (ATL-HPA021224) Datasheet (External Link) |
Vendor Page | Anti FAM180A pAb (ATL-HPA021224) at Atlas Antibodies |
Documents & Links for Anti FAM180A pAb (ATL-HPA021224) | |
Datasheet | Anti FAM180A pAb (ATL-HPA021224) Datasheet (External Link) |
Vendor Page | Anti FAM180A pAb (ATL-HPA021224) |