Anti FAM180A pAb (ATL-HPA021224)

Atlas Antibodies

Catalog No.:
ATL-HPA021224-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 180, member A
Gene Name: FAM180A
Alternative Gene Name: HWKM1940, UNQ1940
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047420: 83%, ENSRNOG00000011750: 83%
Entrez Gene ID: 389558
Uniprot ID: Q6UWF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNN
Gene Sequence MCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNN
Gene ID - Mouse ENSMUSG00000047420
Gene ID - Rat ENSRNOG00000011750
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM180A pAb (ATL-HPA021224)
Datasheet Anti FAM180A pAb (ATL-HPA021224) Datasheet (External Link)
Vendor Page Anti FAM180A pAb (ATL-HPA021224) at Atlas Antibodies

Documents & Links for Anti FAM180A pAb (ATL-HPA021224)
Datasheet Anti FAM180A pAb (ATL-HPA021224) Datasheet (External Link)
Vendor Page Anti FAM180A pAb (ATL-HPA021224)