Anti FAM175B pAb (ATL-HPA037591)

Atlas Antibodies

Catalog No.:
ATL-HPA037591-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 175, member B
Gene Name: FAM175B
Alternative Gene Name: ABRO1, Em:AC068896.4, KIAA0157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030965: 88%, ENSRNOG00000017222: 88%
Entrez Gene ID: 23172
Uniprot ID: Q15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS
Gene Sequence ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS
Gene ID - Mouse ENSMUSG00000030965
Gene ID - Rat ENSRNOG00000017222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM175B pAb (ATL-HPA037591)
Datasheet Anti FAM175B pAb (ATL-HPA037591) Datasheet (External Link)
Vendor Page Anti FAM175B pAb (ATL-HPA037591) at Atlas Antibodies

Documents & Links for Anti FAM175B pAb (ATL-HPA037591)
Datasheet Anti FAM175B pAb (ATL-HPA037591) Datasheet (External Link)
Vendor Page Anti FAM175B pAb (ATL-HPA037591)
Citations for Anti FAM175B pAb (ATL-HPA037591) – 1 Found
Zhao, Yu; Yu, Yang; Li, Hengcun; Zhang, Zheng; Guo, Shuilong; Zhu, Shengtao; Guo, Qingdong; Li, Peng; Min, Li; Zhang, Shutian. FAM175B promotes apoptosis by inhibiting ATF4 ubiquitination in esophageal squamous cell carcinoma. Molecular Oncology. 2019;13(5):1150-1165.  PubMed