Anti FAM175B pAb (ATL-HPA037591)

Atlas Antibodies

SKU: ATL-HPA037591-25

• 
• 

Protein Description: family with sequence similarity 175, member B
Gene Name: FAM175B
Alternative Gene Name: ABRO1, Em:AC068896.4, KIAA0157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030965: 88%, ENSRNOG00000017222: 88%
Entrez Gene ID: 23172
Uniprot ID: Q15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS
• Gene Sequence: ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS
• Gene ID - Mouse: ENSMUSG00000030965
• Gene ID - Rat: ENSRNOG00000017222
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM175B pAb (ATL-HPA037591) – 1 Found

Zhao, Yu; Yu, Yang; Li, Hengcun; Zhang, Zheng; Guo, Shuilong; Zhu, Shengtao; Guo, Qingdong; Li, Peng; Min, Li; Zhang, Shutian. FAM175B promotes apoptosis by inhibiting ATF4 ubiquitination in esophageal squamous cell carcinoma. Molecular Oncology. 2019;13(5):1150-1165.