Anti FAM175B pAb (ATL-HPA037591)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037591-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FAM175B
Alternative Gene Name: ABRO1, Em:AC068896.4, KIAA0157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030965: 88%, ENSRNOG00000017222: 88%
Entrez Gene ID: 23172
Uniprot ID: Q15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS |
| Gene Sequence | ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS |
| Gene ID - Mouse | ENSMUSG00000030965 |
| Gene ID - Rat | ENSRNOG00000017222 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM175B pAb (ATL-HPA037591) | |
| Datasheet | Anti FAM175B pAb (ATL-HPA037591) Datasheet (External Link) |
| Vendor Page | Anti FAM175B pAb (ATL-HPA037591) at Atlas Antibodies |
| Documents & Links for Anti FAM175B pAb (ATL-HPA037591) | |
| Datasheet | Anti FAM175B pAb (ATL-HPA037591) Datasheet (External Link) |
| Vendor Page | Anti FAM175B pAb (ATL-HPA037591) |
| Citations for Anti FAM175B pAb (ATL-HPA037591) – 1 Found |
| Zhao, Yu; Yu, Yang; Li, Hengcun; Zhang, Zheng; Guo, Shuilong; Zhu, Shengtao; Guo, Qingdong; Li, Peng; Min, Li; Zhang, Shutian. FAM175B promotes apoptosis by inhibiting ATF4 ubiquitination in esophageal squamous cell carcinoma. Molecular Oncology. 2019;13(5):1150-1165. PubMed |