Anti FAM172A pAb (ATL-HPA012299 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA012299-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
  • Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-FAM172A antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 172, member A
Gene Name: FAM172A
Alternative Gene Name: C5orf21, DKFZP564D172
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064138: 91%, ENSRNOG00000013844: 73%
Entrez Gene ID: 83989
Uniprot ID: Q8WUF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVSIPVDATESEPKS
Gene Sequence QIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVSIPVDATESEPKS
Gene ID - Mouse ENSMUSG00000064138
Gene ID - Rat ENSRNOG00000013844
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM172A pAb (ATL-HPA012299 w/enhanced validation)
Datasheet Anti FAM172A pAb (ATL-HPA012299 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM172A pAb (ATL-HPA012299 w/enhanced validation)



Citations for Anti FAM172A pAb (ATL-HPA012299 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed