Anti FAM171A2 pAb (ATL-HPA019770)

Atlas Antibodies

SKU:
ATL-HPA019770-25
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 171, member A2
Gene Name: FAM171A2
Alternative Gene Name: MGC34829
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034685: 96%, ENSRNOG00000021041: 97%
Entrez Gene ID: 284069
Uniprot ID: A8MVW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAFPAFLGTEASSSGNGSWLELMPLTAVSVHLLTGNGTEVPLSGPIHLSLPVPSETRALTVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTF
Gene Sequence RAFPAFLGTEASSSGNGSWLELMPLTAVSVHLLTGNGTEVPLSGPIHLSLPVPSETRALTVGTSIPAWRFDPKSGLWVRNGTGVIRKEGRQLYWTF
Gene ID - Mouse ENSMUSG00000034685
Gene ID - Rat ENSRNOG00000021041
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM171A2 pAb (ATL-HPA019770)
Datasheet Anti FAM171A2 pAb (ATL-HPA019770) Datasheet (External Link)
Vendor Page Anti FAM171A2 pAb (ATL-HPA019770) at Atlas Antibodies

Documents & Links for Anti FAM171A2 pAb (ATL-HPA019770)
Datasheet Anti FAM171A2 pAb (ATL-HPA019770) Datasheet (External Link)
Vendor Page Anti FAM171A2 pAb (ATL-HPA019770)



Citations for Anti FAM171A2 pAb (ATL-HPA019770) – 1 Found
Xu, Wei; Han, Si-Da; Zhang, Can; Li, Jie-Qiong; Wang, Yan-Jiang; Tan, Chen-Chen; Li, Hong-Qi; Dong, Qiang; Mei, Cui; Tan, Lan; Yu, Jin-Tai. The FAM171A2 gene is a key regulator of progranulin expression and modifies the risk of multiple neurodegenerative diseases. Science Advances. 2020;6(43)  PubMed