Anti FAM170A pAb (ATL-HPA037900 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA037900-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using Anti-FAM170A antibody. Corresponding FAM170A RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM170A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405332).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 170, member A
Gene Name: FAM170A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035420: 81%, ENSRNOG00000015834: 82%
Entrez Gene ID: 340069
Uniprot ID: A1A519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRN
Gene Sequence VSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRN
Gene ID - Mouse ENSMUSG00000035420
Gene ID - Rat ENSRNOG00000015834
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM170A pAb (ATL-HPA037900 w/enhanced validation)
Datasheet Anti FAM170A pAb (ATL-HPA037900 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM170A pAb (ATL-HPA037900 w/enhanced validation)