Anti FAM170A pAb (ATL-HPA037900 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037900-25

Protein Description: family with sequence similarity 170, member A
Gene Name: FAM170A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035420: 81%, ENSRNOG00000015834: 82%
Entrez Gene ID: 340069
Uniprot ID: A1A519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRN
• Gene Sequence: VSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRN
• Gene ID - Mouse: ENSMUSG00000035420
• Gene ID - Rat: ENSRNOG00000015834
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.