Anti FAM169A pAb (ATL-HPA041574 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041574-25

• 
• 

Protein Description: family with sequence similarity 169, member A
Gene Name: FAM169A
Alternative Gene Name: KIAA0888
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041817: 61%, ENSRNOG00000016505: 59%
Entrez Gene ID: 26049
Uniprot ID: Q9Y6X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPFNSSEDSTNLVPLVVESSKPPEVDAPDKTPRIPDSEMLMDEGTSDEKGHMEEKLSLLPRKKAHLGSSDNVATMSNEERSDGGFPNSVIAEFSEEP
• Gene Sequence: QPFNSSEDSTNLVPLVVESSKPPEVDAPDKTPRIPDSEMLMDEGTSDEKGHMEEKLSLLPRKKAHLGSSDNVATMSNEERSDGGFPNSVIAEFSEEP
• Gene ID - Mouse: ENSMUSG00000041817
• Gene ID - Rat: ENSRNOG00000016505
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.