Anti FAM167A pAb (ATL-HPA030426 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA030426-25

• 
• 

Protein Description: family with sequence similarity 167, member A
Gene Name: FAM167A
Alternative Gene Name: C8orf13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035095: 74%, ENSRNOG00000011316: 76%
Entrez Gene ID: 83648
Uniprot ID: Q96KS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQEPLLPLREAGQHPPSARSASQGARPLSSGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMR
• Gene Sequence: GQEPLLPLREAGQHPPSARSASQGARPLSSGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMR
• Gene ID - Mouse: ENSMUSG00000035095
• Gene ID - Rat: ENSRNOG00000011316
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM167A pAb (ATL-HPA030426 w/enhanced validation) – 1 Found

Mentlein, L; Thorlacius, G E; Meneghel, L; Aqrawi, L A; Ramírez Sepúlveda, J I; Grunewald, J; Espinosa, A; Wahren-Herlenius, M. The rheumatic disease-associated FAM167A-BLK locus encodes DIORA-1, a novel disordered protein expressed highly in bronchial epithelium and alveolar macrophages. Clinical And Experimental Immunology. 2018;193(2):167-177.