Anti FAM161A pAb (ATL-HPA032119)

Atlas Antibodies

SKU: ATL-HPA032119-25

• 

Protein Description: family with sequence similarity 161, member A
Gene Name: FAM161A
Alternative Gene Name: FLJ13305, RP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049811: 57%, ENSRNOG00000009881: 53%
Entrez Gene ID: 84140
Uniprot ID: Q3B820
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSPKLLTVCKPFDLHASPHASIKREKILADIEADEENLKETRWPYLSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMR
• Gene Sequence: KSPKLLTVCKPFDLHASPHASIKREKILADIEADEENLKETRWPYLSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMR
• Gene ID - Mouse: ENSMUSG00000049811
• Gene ID - Rat: ENSRNOG00000009881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM161A pAb (ATL-HPA032119) – 2 Found

Beryozkin, Avigail; Matsevich, Chen; Obolensky, Alexey; Kostic, Corinne; Arsenijevic, Yvan; Wolfrum, Uwe; Banin, Eyal; Sharon, Dror. A new mouse model for retinal degeneration due to Fam161a deficiency. Scientific Reports. 2021;11(1):2030. 

Matsevich, Chen; Gopalakrishnan, Prakadeeswari; Obolensky, Alexey; Banin, Eyal; Sharon, Dror; Beryozkin, Avigail. Retinal Structure and Function in a Knock-in Mouse Model for the FAM161A-p.Arg523∗ Human Nonsense Pathogenic Variant. Ophthalmology Science. 2023;3(1):100229.