Anti FAM155A pAb (ATL-HPA039453 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039453-25

• 
• 

Protein Description: family with sequence similarity 155, member A
Gene Name: FAM155A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079157: 82%, ENSRNOG00000030625: 28%
Entrez Gene ID: 728215
Uniprot ID: B1AL88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPL
• Gene Sequence: GNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPL
• Gene ID - Mouse: ENSMUSG00000079157
• Gene ID - Rat: ENSRNOG00000030625
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.