Anti FAM153B pAb (ATL-HPA055498)

Atlas Antibodies

Catalog No.:
ATL-HPA055498-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 153, member B
Gene Name: FAM153B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020605: 39%, ENSRNOG00000008334: 39%
Entrez Gene ID: 202134
Uniprot ID: P0C7A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQ
Gene Sequence DPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQ
Gene ID - Mouse ENSMUSG00000020605
Gene ID - Rat ENSRNOG00000008334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM153B pAb (ATL-HPA055498)
Datasheet Anti FAM153B pAb (ATL-HPA055498) Datasheet (External Link)
Vendor Page Anti FAM153B pAb (ATL-HPA055498) at Atlas Antibodies

Documents & Links for Anti FAM153B pAb (ATL-HPA055498)
Datasheet Anti FAM153B pAb (ATL-HPA055498) Datasheet (External Link)
Vendor Page Anti FAM153B pAb (ATL-HPA055498)