Anti FAM153B pAb (ATL-HPA055498)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055498-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM153B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020605: 39%, ENSRNOG00000008334: 39%
Entrez Gene ID: 202134
Uniprot ID: P0C7A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQ |
| Gene Sequence | DPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQ |
| Gene ID - Mouse | ENSMUSG00000020605 |
| Gene ID - Rat | ENSRNOG00000008334 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM153B pAb (ATL-HPA055498) | |
| Datasheet | Anti FAM153B pAb (ATL-HPA055498) Datasheet (External Link) |
| Vendor Page | Anti FAM153B pAb (ATL-HPA055498) at Atlas Antibodies |
| Documents & Links for Anti FAM153B pAb (ATL-HPA055498) | |
| Datasheet | Anti FAM153B pAb (ATL-HPA055498) Datasheet (External Link) |
| Vendor Page | Anti FAM153B pAb (ATL-HPA055498) |