Anti FAM153A pAb (ATL-HPA052337)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052337-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM153A
Alternative Gene Name: NY-REN-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061195: 36%, ENSRNOG00000050191: 36%
Entrez Gene ID: 285596
Uniprot ID: Q9UHL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMK |
| Gene Sequence | MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMK |
| Gene ID - Mouse | ENSMUSG00000061195 |
| Gene ID - Rat | ENSRNOG00000050191 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM153A pAb (ATL-HPA052337) | |
| Datasheet | Anti FAM153A pAb (ATL-HPA052337) Datasheet (External Link) |
| Vendor Page | Anti FAM153A pAb (ATL-HPA052337) at Atlas Antibodies |
| Documents & Links for Anti FAM153A pAb (ATL-HPA052337) | |
| Datasheet | Anti FAM153A pAb (ATL-HPA052337) Datasheet (External Link) |
| Vendor Page | Anti FAM153A pAb (ATL-HPA052337) |