Anti FAM153A pAb (ATL-HPA052337)

Atlas Antibodies

Catalog No.:
ATL-HPA052337-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 153, member A
Gene Name: FAM153A
Alternative Gene Name: NY-REN-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061195: 36%, ENSRNOG00000050191: 36%
Entrez Gene ID: 285596
Uniprot ID: Q9UHL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMK
Gene Sequence MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMK
Gene ID - Mouse ENSMUSG00000061195
Gene ID - Rat ENSRNOG00000050191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM153A pAb (ATL-HPA052337)
Datasheet Anti FAM153A pAb (ATL-HPA052337) Datasheet (External Link)
Vendor Page Anti FAM153A pAb (ATL-HPA052337) at Atlas Antibodies

Documents & Links for Anti FAM153A pAb (ATL-HPA052337)
Datasheet Anti FAM153A pAb (ATL-HPA052337) Datasheet (External Link)
Vendor Page Anti FAM153A pAb (ATL-HPA052337)