Anti FAM153A pAb (ATL-HPA044022)

Atlas Antibodies

Catalog No.: ATL-HPA044022-25

Protein Description: family with sequence similarity 153, member A
Gene Name: FAM153A
Alternative Gene Name: NY-REN-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061607: 31%, ENSRNOG00000017354: 34%
Entrez Gene ID: 285596
Uniprot ID: Q9UHL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVA
• Gene Sequence: RDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVA
• Gene ID - Mouse: ENSMUSG00000061607
• Gene ID - Rat: ENSRNOG00000017354
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.