Anti FAM153A pAb (ATL-HPA044022)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044022-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FAM153A
Alternative Gene Name: NY-REN-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061607: 31%, ENSRNOG00000017354: 34%
Entrez Gene ID: 285596
Uniprot ID: Q9UHL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVA |
Gene Sequence | RDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVA |
Gene ID - Mouse | ENSMUSG00000061607 |
Gene ID - Rat | ENSRNOG00000017354 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM153A pAb (ATL-HPA044022) | |
Datasheet | Anti FAM153A pAb (ATL-HPA044022) Datasheet (External Link) |
Vendor Page | Anti FAM153A pAb (ATL-HPA044022) at Atlas Antibodies |
Documents & Links for Anti FAM153A pAb (ATL-HPA044022) | |
Datasheet | Anti FAM153A pAb (ATL-HPA044022) Datasheet (External Link) |
Vendor Page | Anti FAM153A pAb (ATL-HPA044022) |