Anti FAM153A pAb (ATL-HPA042585)

Atlas Antibodies

SKU:
ATL-HPA042585-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic and nuclear positivity in myocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 153, member A
Gene Name: FAM153A
Alternative Gene Name: NY-REN-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020409: 43%, ENSRNOG00000022598: 36%
Entrez Gene ID: 285596
Uniprot ID: Q9UHL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPS
Gene Sequence EDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPS
Gene ID - Mouse ENSMUSG00000020409
Gene ID - Rat ENSRNOG00000022598
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM153A pAb (ATL-HPA042585)
Datasheet Anti FAM153A pAb (ATL-HPA042585) Datasheet (External Link)
Vendor Page Anti FAM153A pAb (ATL-HPA042585) at Atlas Antibodies

Documents & Links for Anti FAM153A pAb (ATL-HPA042585)
Datasheet Anti FAM153A pAb (ATL-HPA042585) Datasheet (External Link)
Vendor Page Anti FAM153A pAb (ATL-HPA042585)