Anti FAM149B1 pAb (ATL-HPA039189)

Atlas Antibodies

SKU: ATL-HPA039189-25

• 
• 

Protein Description: family with sequence similarity 149, member B1
Gene Name: FAM149B1
Alternative Gene Name: KIAA0974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039599: 68%, ENSRNOG00000006554: 71%
Entrez Gene ID: 317662
Uniprot ID: Q96BN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCSMERDEEDSIIVSEGIIEEYLAFDHIDIEEG
• Gene Sequence: ERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCSMERDEEDSIIVSEGIIEEYLAFDHIDIEEG
• Gene ID - Mouse: ENSMUSG00000039599
• Gene ID - Rat: ENSRNOG00000006554
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.