Anti FAM149B1 pAb (ATL-HPA039189)

Atlas Antibodies

Catalog No.:
ATL-HPA039189-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 149, member B1
Gene Name: FAM149B1
Alternative Gene Name: KIAA0974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039599: 68%, ENSRNOG00000006554: 71%
Entrez Gene ID: 317662
Uniprot ID: Q96BN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCSMERDEEDSIIVSEGIIEEYLAFDHIDIEEG
Gene Sequence ERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCSMERDEEDSIIVSEGIIEEYLAFDHIDIEEG
Gene ID - Mouse ENSMUSG00000039599
Gene ID - Rat ENSRNOG00000006554
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM149B1 pAb (ATL-HPA039189)
Datasheet Anti FAM149B1 pAb (ATL-HPA039189) Datasheet (External Link)
Vendor Page Anti FAM149B1 pAb (ATL-HPA039189) at Atlas Antibodies

Documents & Links for Anti FAM149B1 pAb (ATL-HPA039189)
Datasheet Anti FAM149B1 pAb (ATL-HPA039189) Datasheet (External Link)
Vendor Page Anti FAM149B1 pAb (ATL-HPA039189)