Anti FAM149B1 pAb (ATL-HPA039189)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039189-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FAM149B1
Alternative Gene Name: KIAA0974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039599: 68%, ENSRNOG00000006554: 71%
Entrez Gene ID: 317662
Uniprot ID: Q96BN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCSMERDEEDSIIVSEGIIEEYLAFDHIDIEEG |
Gene Sequence | ERDSTIFGIRGKKLHFSSSYAHKASSIAKSSSFCSMERDEEDSIIVSEGIIEEYLAFDHIDIEEG |
Gene ID - Mouse | ENSMUSG00000039599 |
Gene ID - Rat | ENSRNOG00000006554 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM149B1 pAb (ATL-HPA039189) | |
Datasheet | Anti FAM149B1 pAb (ATL-HPA039189) Datasheet (External Link) |
Vendor Page | Anti FAM149B1 pAb (ATL-HPA039189) at Atlas Antibodies |
Documents & Links for Anti FAM149B1 pAb (ATL-HPA039189) | |
Datasheet | Anti FAM149B1 pAb (ATL-HPA039189) Datasheet (External Link) |
Vendor Page | Anti FAM149B1 pAb (ATL-HPA039189) |