Anti FAM135A pAb (ATL-HPA031744)

Atlas Antibodies

Catalog No.:
ATL-HPA031744-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 135, member A
Gene Name: FAM135A
Alternative Gene Name: FLJ20176, KIAA1411
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026153: 67%, ENSRNOG00000013587: 64%
Entrez Gene ID: 57579
Uniprot ID: Q9P2D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKS
Gene Sequence ISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKS
Gene ID - Mouse ENSMUSG00000026153
Gene ID - Rat ENSRNOG00000013587
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM135A pAb (ATL-HPA031744)
Datasheet Anti FAM135A pAb (ATL-HPA031744) Datasheet (External Link)
Vendor Page Anti FAM135A pAb (ATL-HPA031744) at Atlas Antibodies

Documents & Links for Anti FAM135A pAb (ATL-HPA031744)
Datasheet Anti FAM135A pAb (ATL-HPA031744) Datasheet (External Link)
Vendor Page Anti FAM135A pAb (ATL-HPA031744)