Anti FAM135A pAb (ATL-HPA031744)

Atlas Antibodies

SKU: ATL-HPA031744-25

• 
• 

Protein Description: family with sequence similarity 135, member A
Gene Name: FAM135A
Alternative Gene Name: FLJ20176, KIAA1411
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026153: 67%, ENSRNOG00000013587: 64%
Entrez Gene ID: 57579
Uniprot ID: Q9P2D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKS
• Gene Sequence: ISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKS
• Gene ID - Mouse: ENSMUSG00000026153
• Gene ID - Rat: ENSRNOG00000013587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.