Anti FAM135A pAb (ATL-HPA031744)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031744-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FAM135A
Alternative Gene Name: FLJ20176, KIAA1411
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026153: 67%, ENSRNOG00000013587: 64%
Entrez Gene ID: 57579
Uniprot ID: Q9P2D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKS |
| Gene Sequence | ISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKS |
| Gene ID - Mouse | ENSMUSG00000026153 |
| Gene ID - Rat | ENSRNOG00000013587 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM135A pAb (ATL-HPA031744) | |
| Datasheet | Anti FAM135A pAb (ATL-HPA031744) Datasheet (External Link) |
| Vendor Page | Anti FAM135A pAb (ATL-HPA031744) at Atlas Antibodies |
| Documents & Links for Anti FAM135A pAb (ATL-HPA031744) | |
| Datasheet | Anti FAM135A pAb (ATL-HPA031744) Datasheet (External Link) |
| Vendor Page | Anti FAM135A pAb (ATL-HPA031744) |