Anti FAM134C pAb (ATL-HPA016492)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016492-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: FAM134C
Alternative Gene Name: DKFZp686B1036, FLJ33806
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017802: 86%, ENSRNOG00000020056: 85%
Entrez Gene ID: 162427
Uniprot ID: Q86VR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE |
| Gene Sequence | DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE |
| Gene ID - Mouse | ENSMUSG00000017802 |
| Gene ID - Rat | ENSRNOG00000020056 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM134C pAb (ATL-HPA016492) | |
| Datasheet | Anti FAM134C pAb (ATL-HPA016492) Datasheet (External Link) |
| Vendor Page | Anti FAM134C pAb (ATL-HPA016492) at Atlas Antibodies |
| Documents & Links for Anti FAM134C pAb (ATL-HPA016492) | |
| Datasheet | Anti FAM134C pAb (ATL-HPA016492) Datasheet (External Link) |
| Vendor Page | Anti FAM134C pAb (ATL-HPA016492) |