Anti FAM134C pAb (ATL-HPA016492)

Atlas Antibodies

SKU: ATL-HPA016492-100

• 
• 
• 

Protein Description: family with sequence similarity 134, member C
Gene Name: FAM134C
Alternative Gene Name: DKFZp686B1036, FLJ33806
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017802: 86%, ENSRNOG00000020056: 85%
Entrez Gene ID: 162427
Uniprot ID: Q86VR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE
• Gene Sequence: DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE
• Gene ID - Mouse: ENSMUSG00000017802
• Gene ID - Rat: ENSRNOG00000020056
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.