Anti FAM131A pAb (ATL-HPA042800)

Atlas Antibodies

Catalog No.:
ATL-HPA042800-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 131, member A
Gene Name: FAM131A
Alternative Gene Name: C3orf40, MGC21688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050821: 87%, ENSRNOG00000046177: 85%
Entrez Gene ID: 131408
Uniprot ID: Q6UXB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSL
Gene Sequence ELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSL
Gene ID - Mouse ENSMUSG00000050821
Gene ID - Rat ENSRNOG00000046177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM131A pAb (ATL-HPA042800)
Datasheet Anti FAM131A pAb (ATL-HPA042800) Datasheet (External Link)
Vendor Page Anti FAM131A pAb (ATL-HPA042800) at Atlas Antibodies

Documents & Links for Anti FAM131A pAb (ATL-HPA042800)
Datasheet Anti FAM131A pAb (ATL-HPA042800) Datasheet (External Link)
Vendor Page Anti FAM131A pAb (ATL-HPA042800)