Anti FAM131A pAb (ATL-HPA042800)

Atlas Antibodies

Catalog No.: ATL-HPA042800-25

Protein Description: family with sequence similarity 131, member A
Gene Name: FAM131A
Alternative Gene Name: C3orf40, MGC21688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050821: 87%, ENSRNOG00000046177: 85%
Entrez Gene ID: 131408
Uniprot ID: Q6UXB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSL
• Gene Sequence: ELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSL
• Gene ID - Mouse: ENSMUSG00000050821
• Gene ID - Rat: ENSRNOG00000046177
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.