Anti FAM129B pAb (ATL-HPA024312 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024312-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: FAM129B
Alternative Gene Name: bA356B19.6, C9orf88, DKFZP434H0820, FLJ13518, FLJ22151, FLJ22298, MINERVA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026796: 91%, ENSRNOG00000015845: 90%
Entrez Gene ID: 64855
Uniprot ID: Q96TA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSV |
| Gene Sequence | FLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSV |
| Gene ID - Mouse | ENSMUSG00000026796 |
| Gene ID - Rat | ENSRNOG00000015845 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM129B pAb (ATL-HPA024312 w/enhanced validation) | |
| Datasheet | Anti FAM129B pAb (ATL-HPA024312 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FAM129B pAb (ATL-HPA024312 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FAM129B pAb (ATL-HPA024312 w/enhanced validation) | |
| Datasheet | Anti FAM129B pAb (ATL-HPA024312 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FAM129B pAb (ATL-HPA024312 w/enhanced validation) |
| Citations for Anti FAM129B pAb (ATL-HPA024312 w/enhanced validation) – 1 Found |
| Zhou, Xiaoming; Yang, Fangfei; Zhang, Qin; Miao, Yuan; Hu, Xuejun; Li, Ailin; Hou, Gang; Wang, Qiuyue; Kang, Jian. FAM129B promoted tumor invasion and proliferation via facilitating the phosphorylation of FAK signaling and associated with adverse clinical outcome of non-small cell lung cancer patients. Oncotargets And Therapy. 11( 30498362):7493-7501. PubMed |