Anti FAM129B pAb (ATL-HPA023261 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023261-25

• 
• 

Protein Description: family with sequence similarity 129, member B
Gene Name: FAM129B
Alternative Gene Name: bA356B19.6, C9orf88, DKFZP434H0820, FLJ13518, FLJ22151, FLJ22298, MINERVA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026796: 87%, ENSRNOG00000015845: 87%
Entrez Gene ID: 64855
Uniprot ID: Q96TA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHV
• Gene Sequence: LSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHV
• Gene ID - Mouse: ENSMUSG00000026796
• Gene ID - Rat: ENSRNOG00000015845
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM129B pAb (ATL-HPA023261 w/enhanced validation) – 1 Found

Conrad, Willliam; Major, Michael B; Cleary, Michele A; Ferrer, Marc; Roberts, Brian; Marine, Shane; Chung, Namjin; Arthur, William T; Moon, Randall T; Berndt, Jason D; Chien, Andy J. FAM129B is a novel regulator of Wnt/β-catenin signal transduction in melanoma cells. F1000research. 2( 24358901):134.