Anti FAM129B pAb (ATL-HPA021284)

Atlas Antibodies

SKU:
ATL-HPA021284-25
  • Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in seminiferous duct cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 129, member B
Gene Name: FAM129B
Alternative Gene Name: bA356B19.6, C9orf88, DKFZP434H0820, FLJ13518, FLJ22151, FLJ22298, MINERVA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026796: 97%, ENSRNOG00000015845: 97%
Entrez Gene ID: 64855
Uniprot ID: Q96TA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRV
Gene Sequence EVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRV
Gene ID - Mouse ENSMUSG00000026796
Gene ID - Rat ENSRNOG00000015845
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM129B pAb (ATL-HPA021284)
Datasheet Anti FAM129B pAb (ATL-HPA021284) Datasheet (External Link)
Vendor Page Anti FAM129B pAb (ATL-HPA021284) at Atlas Antibodies

Documents & Links for Anti FAM129B pAb (ATL-HPA021284)
Datasheet Anti FAM129B pAb (ATL-HPA021284) Datasheet (External Link)
Vendor Page Anti FAM129B pAb (ATL-HPA021284)