Anti FAM129A pAb (ATL-HPA028657 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028657-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM129A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409367).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 129, member A
Gene Name: FAM129A
Alternative Gene Name: C1orf24, GIG39, NIBAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026483: 74%, ENSRNOG00000002403: 75%
Entrez Gene ID: 116496
Uniprot ID: Q9BZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILLDETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDLKPPTGSNQASPARRASAILPGVLGSETLSNEVFQESEEEKQPEVPSSLAKGESLSLPGP
Gene Sequence ILLDETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDLKPPTGSNQASPARRASAILPGVLGSETLSNEVFQESEEEKQPEVPSSLAKGESLSLPGP
Gene ID - Mouse ENSMUSG00000026483
Gene ID - Rat ENSRNOG00000002403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM129A pAb (ATL-HPA028657 w/enhanced validation)
Datasheet Anti FAM129A pAb (ATL-HPA028657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM129A pAb (ATL-HPA028657 w/enhanced validation)