Anti FAM126B pAb (ATL-HPA036167)

Atlas Antibodies

Catalog No.:
ATL-HPA036167-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 126, member B
Gene Name: FAM126B
Alternative Gene Name: HYCC2, MGC39518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038174: 89%, ENSRNOG00000025079: 89%
Entrez Gene ID: 285172
Uniprot ID: Q8IXS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSLRKVATGRSAKDKETASAIKSSESPRDSVVRKQYVQQPTDLSVDSVELTPMKKHLSLPAGQVVP
Gene Sequence GSLRKVATGRSAKDKETASAIKSSESPRDSVVRKQYVQQPTDLSVDSVELTPMKKHLSLPAGQVVP
Gene ID - Mouse ENSMUSG00000038174
Gene ID - Rat ENSRNOG00000025079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM126B pAb (ATL-HPA036167)
Datasheet Anti FAM126B pAb (ATL-HPA036167) Datasheet (External Link)
Vendor Page Anti FAM126B pAb (ATL-HPA036167) at Atlas Antibodies

Documents & Links for Anti FAM126B pAb (ATL-HPA036167)
Datasheet Anti FAM126B pAb (ATL-HPA036167) Datasheet (External Link)
Vendor Page Anti FAM126B pAb (ATL-HPA036167)