Anti FAM126A pAb (ATL-HPA042873 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA042873-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM126A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403173).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 126, member A
Gene Name: FAM126A
Alternative Gene Name: DRCTNNB1A , HCC, HYCC1, hyccin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028995: 82%, ENSRNOG00000010517: 77%
Entrez Gene ID: 84668
Uniprot ID: Q9BYI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQ
Gene Sequence PSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEKLIYVSERTELPMKHQSGQQ
Gene ID - Mouse ENSMUSG00000028995
Gene ID - Rat ENSRNOG00000010517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM126A pAb (ATL-HPA042873 w/enhanced validation)
Datasheet Anti FAM126A pAb (ATL-HPA042873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM126A pAb (ATL-HPA042873 w/enhanced validation)