Anti FAM124B pAb (ATL-HPA070240)

Atlas Antibodies

Catalog No.:
ATL-HPA070240-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 124B
Gene Name: FAM124B
Alternative Gene Name: FLJ22746
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043230: 73%, ENSRNOG00000054416: 76%
Entrez Gene ID: 79843
Uniprot ID: Q9H5Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQ
Gene Sequence MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQ
Gene ID - Mouse ENSMUSG00000043230
Gene ID - Rat ENSRNOG00000054416
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM124B pAb (ATL-HPA070240)
Datasheet Anti FAM124B pAb (ATL-HPA070240) Datasheet (External Link)
Vendor Page Anti FAM124B pAb (ATL-HPA070240) at Atlas Antibodies

Documents & Links for Anti FAM124B pAb (ATL-HPA070240)
Datasheet Anti FAM124B pAb (ATL-HPA070240) Datasheet (External Link)
Vendor Page Anti FAM124B pAb (ATL-HPA070240)