Anti FAM120A pAb (ATL-HPA019734)

Atlas Antibodies

Catalog No.:
ATL-HPA019734-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 120A
Gene Name: FAM120A
Alternative Gene Name: C9orf10, DNAPTP1, KIAA0183, OSSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038014: 93%, ENSRNOG00000016779: 94%
Entrez Gene ID: 23196
Uniprot ID: Q9NZB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPL
Gene Sequence SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPL
Gene ID - Mouse ENSMUSG00000038014
Gene ID - Rat ENSRNOG00000016779
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM120A pAb (ATL-HPA019734)
Datasheet Anti FAM120A pAb (ATL-HPA019734) Datasheet (External Link)
Vendor Page Anti FAM120A pAb (ATL-HPA019734) at Atlas Antibodies

Documents & Links for Anti FAM120A pAb (ATL-HPA019734)
Datasheet Anti FAM120A pAb (ATL-HPA019734) Datasheet (External Link)
Vendor Page Anti FAM120A pAb (ATL-HPA019734)
Citations for Anti FAM120A pAb (ATL-HPA019734) – 2 Found
Burke, James M; Lester, Evan T; Tauber, Devin; Parker, Roy. RNase L promotes the formation of unique ribonucleoprotein granules distinct from stress granules. The Journal Of Biological Chemistry. 2020;295(6):1426-1438.  PubMed
Burke, James M; Ripin, Nina; Ferretti, Max B; St Clair, Laura A; Worden-Sapper, Emma R; Salgado, Fernando; Sawyer, Sara L; Perera, Rushika; Lynch, Kristen W; Parker, Roy. RNase L activation in the cytoplasm induces aberrant processing of mRNAs in the nucleus. Plos Pathogens. 2022;18(11):e1010930.  PubMed