Anti FAM118B pAb (ATL-HPA042100)

Atlas Antibodies

Catalog No.:
ATL-HPA042100-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 118, member B
Gene Name: FAM118B
Alternative Gene Name: FLJ21103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050471: 95%, ENSRNOG00000011543: 94%
Entrez Gene ID: 79607
Uniprot ID: Q9BPY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHKSDLEHFMLVRRGDVDEFKKLRENMLDKGIKVISYGDDYADLPEYFKRLTCEISTRGTSAGMVREGQLNGSSAAHSE
Gene Sequence KHKSDLEHFMLVRRGDVDEFKKLRENMLDKGIKVISYGDDYADLPEYFKRLTCEISTRGTSAGMVREGQLNGSSAAHSE
Gene ID - Mouse ENSMUSG00000050471
Gene ID - Rat ENSRNOG00000011543
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM118B pAb (ATL-HPA042100)
Datasheet Anti FAM118B pAb (ATL-HPA042100) Datasheet (External Link)
Vendor Page Anti FAM118B pAb (ATL-HPA042100) at Atlas Antibodies

Documents & Links for Anti FAM118B pAb (ATL-HPA042100)
Datasheet Anti FAM118B pAb (ATL-HPA042100) Datasheet (External Link)
Vendor Page Anti FAM118B pAb (ATL-HPA042100)