Anti FAM118B pAb (ATL-HPA041644 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041644-25

• 
• 

Protein Description: family with sequence similarity 118, member B
Gene Name: FAM118B
Alternative Gene Name: FLJ21103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050471: 100%, ENSRNOG00000011543: 100%
Entrez Gene ID: 79607
Uniprot ID: Q9BPY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLESLDLTDEKKVLEWAQEKRKLSVLHIHGVYTNPSGIVLHPAGYQNVLRNTEVMREIQKLYENKSFLFLGCG
• Gene Sequence: QLESLDLTDEKKVLEWAQEKRKLSVLHIHGVYTNPSGIVLHPAGYQNVLRNTEVMREIQKLYENKSFLFLGCG
• Gene ID - Mouse: ENSMUSG00000050471
• Gene ID - Rat: ENSRNOG00000011543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.