Anti FAM114A2 pAb (ATL-HPA035870)

Atlas Antibodies

Catalog No.:
ATL-HPA035870-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 114, member A2
Gene Name: FAM114A2
Alternative Gene Name: 133K02, C5orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020523: 82%, ENSRNOG00000002423: 82%
Entrez Gene ID: 10827
Uniprot ID: Q9NRY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SATVATVGQGISNVIEKAETSLGIPSPSEISTEVKYVAGETNAKENENSSPVAGAFGVFSTISTAVQSTGKSVISG
Gene Sequence SATVATVGQGISNVIEKAETSLGIPSPSEISTEVKYVAGETNAKENENSSPVAGAFGVFSTISTAVQSTGKSVISG
Gene ID - Mouse ENSMUSG00000020523
Gene ID - Rat ENSRNOG00000002423
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM114A2 pAb (ATL-HPA035870)
Datasheet Anti FAM114A2 pAb (ATL-HPA035870) Datasheet (External Link)
Vendor Page Anti FAM114A2 pAb (ATL-HPA035870) at Atlas Antibodies

Documents & Links for Anti FAM114A2 pAb (ATL-HPA035870)
Datasheet Anti FAM114A2 pAb (ATL-HPA035870) Datasheet (External Link)
Vendor Page Anti FAM114A2 pAb (ATL-HPA035870)