Anti FAM110D pAb (ATL-HPA013664)

Atlas Antibodies

SKU: ATL-HPA013664-25

• 

Protein Description: family with sequence similarity 110, member D
Gene Name: FAM110D
Alternative Gene Name: FLJ14050, GRRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050105: 89%, ENSRNOG00000016491: 87%
Entrez Gene ID: 79927
Uniprot ID: Q8TAY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HQVIARRQEPALRGSPGPLTPHPCNELGPPASPRTPRPVRRGSGRRLPRPDSLIFYRQKRDC
• Gene Sequence: HQVIARRQEPALRGSPGPLTPHPCNELGPPASPRTPRPVRRGSGRRLPRPDSLIFYRQKRDC
• Gene ID - Mouse: ENSMUSG00000050105
• Gene ID - Rat: ENSRNOG00000016491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.