Anti FAM110D pAb (ATL-HPA013664)

Atlas Antibodies

Catalog No.:
ATL-HPA013664-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 110, member D
Gene Name: FAM110D
Alternative Gene Name: FLJ14050, GRRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050105: 89%, ENSRNOG00000016491: 87%
Entrez Gene ID: 79927
Uniprot ID: Q8TAY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HQVIARRQEPALRGSPGPLTPHPCNELGPPASPRTPRPVRRGSGRRLPRPDSLIFYRQKRDC
Gene Sequence HQVIARRQEPALRGSPGPLTPHPCNELGPPASPRTPRPVRRGSGRRLPRPDSLIFYRQKRDC
Gene ID - Mouse ENSMUSG00000050105
Gene ID - Rat ENSRNOG00000016491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM110D pAb (ATL-HPA013664)
Datasheet Anti FAM110D pAb (ATL-HPA013664) Datasheet (External Link)
Vendor Page Anti FAM110D pAb (ATL-HPA013664) at Atlas Antibodies

Documents & Links for Anti FAM110D pAb (ATL-HPA013664)
Datasheet Anti FAM110D pAb (ATL-HPA013664) Datasheet (External Link)
Vendor Page Anti FAM110D pAb (ATL-HPA013664)