Anti FAM110C pAb (ATL-HPA036144)

Atlas Antibodies

SKU: ATL-HPA036144-25

• 

Protein Description: family with sequence similarity 110, member C
Gene Name: FAM110C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036136: 55%, ENSRNOG00000005660: 56%
Entrez Gene ID: 642273
Uniprot ID: Q1W6H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAGNPETV
• Gene Sequence: IYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAGNPETV
• Gene ID - Mouse: ENSMUSG00000036136
• Gene ID - Rat: ENSRNOG00000005660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.