Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041923-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 103, member A1
Gene Name: FAM103A1
Alternative Gene Name: C15orf18, HsT19360, MGC2560, RAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038646: 87%, ENSRNOG00000019426: 82%
Entrez Gene ID: 83640
Uniprot ID: Q9BTL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY
Gene Sequence QDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY
Gene ID - Mouse ENSMUSG00000038646
Gene ID - Rat ENSRNOG00000019426
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation)
Datasheet Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation)
Datasheet Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation)
Citations for Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) – 1 Found
Landegren, Nils; Sharon, Donald; Freyhult, Eva; Hallgren, Åsa; Eriksson, Daniel; Edqvist, Per-Henrik; Bensing, Sophie; Wahlberg, Jeanette; Nelson, Lawrence M; Gustafsson, Jan; Husebye, Eystein S; Anderson, Mark S; Snyder, Michael; Kämpe, Olle. Proteome-wide survey of the autoimmune target repertoire in autoimmune polyendocrine syndrome type 1. Scientific Reports. 2016;6( 26830021):20104.  PubMed