Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041923-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FAM103A1
Alternative Gene Name: C15orf18, HsT19360, MGC2560, RAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038646: 87%, ENSRNOG00000019426: 82%
Entrez Gene ID: 83640
Uniprot ID: Q9BTL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY |
| Gene Sequence | QDNRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY |
| Gene ID - Mouse | ENSMUSG00000038646 |
| Gene ID - Rat | ENSRNOG00000019426 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) | |
| Datasheet | Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) | |
| Datasheet | Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) |
| Citations for Anti FAM103A1 pAb (ATL-HPA041923 w/enhanced validation) – 1 Found |
| Landegren, Nils; Sharon, Donald; Freyhult, Eva; Hallgren, Åsa; Eriksson, Daniel; Edqvist, Per-Henrik; Bensing, Sophie; Wahlberg, Jeanette; Nelson, Lawrence M; Gustafsson, Jan; Husebye, Eystein S; Anderson, Mark S; Snyder, Michael; Kämpe, Olle. Proteome-wide survey of the autoimmune target repertoire in autoimmune polyendocrine syndrome type 1. Scientific Reports. 2016;6( 26830021):20104. PubMed |