Anti FAM102B pAb (ATL-HPA028451)

Atlas Antibodies

SKU: ATL-HPA028451-25

• 
• 

Protein Description: family with sequence similarity 102, member B
Gene Name: FAM102B
Alternative Gene Name: DKFZp779B126, SYM-3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040339: 77%, ENSRNOG00000027540: 80%
Entrez Gene ID: 284611
Uniprot ID: Q5T8I3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLSRCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQD
• Gene Sequence: SRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLSRCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQD
• Gene ID - Mouse: ENSMUSG00000040339
• Gene ID - Rat: ENSRNOG00000027540
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.