Anti FAH pAb (ATL-HPA041370 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041370-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fumarylacetoacetate hydrolase (fumarylacetoacetase)
Gene Name: FAH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030630: 88%, ENSRNOG00000013223: 88%
Entrez Gene ID: 2184
Uniprot ID: P16930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGD
Gene Sequence INLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGD
Gene ID - Mouse ENSMUSG00000030630
Gene ID - Rat ENSRNOG00000013223
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAH pAb (ATL-HPA041370 w/enhanced validation)
Datasheet Anti FAH pAb (ATL-HPA041370 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAH pAb (ATL-HPA041370 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FAH pAb (ATL-HPA041370 w/enhanced validation)
Datasheet Anti FAH pAb (ATL-HPA041370 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAH pAb (ATL-HPA041370 w/enhanced validation)
Citations for Anti FAH pAb (ATL-HPA041370 w/enhanced validation) – 2 Found
Nguyen, Tran N; Nguyen, Ha Q; Le, Duc-Hau. Unveiling prognostics biomarkers of tyrosine metabolism reprogramming in liver cancer by cross-platform gene expression analyses. Plos One. 15(6):e0229276.  PubMed
Colemonts-Vroninks, Haaike; Neuckermans, Jessie; Marcelis, Lionel; Claes, Paul; Branson, Steven; Casimir, Georges; Goyens, Philippe; Martens, Geert A; Vanhaecke, Tamara; De Kock, Joery. Oxidative Stress, Glutathione Metabolism, and Liver Regeneration Pathways Are Activated in Hereditary Tyrosinemia Type 1 Mice upon Short-Term Nitisinone Discontinuation. Genes. 2020;12(1)  PubMed