Anti FAH pAb (ATL-HPA041370 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041370-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: FAH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030630: 88%, ENSRNOG00000013223: 88%
Entrez Gene ID: 2184
Uniprot ID: P16930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | INLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGD |
| Gene Sequence | INLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGD |
| Gene ID - Mouse | ENSMUSG00000030630 |
| Gene ID - Rat | ENSRNOG00000013223 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAH pAb (ATL-HPA041370 w/enhanced validation) | |
| Datasheet | Anti FAH pAb (ATL-HPA041370 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FAH pAb (ATL-HPA041370 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FAH pAb (ATL-HPA041370 w/enhanced validation) | |
| Datasheet | Anti FAH pAb (ATL-HPA041370 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FAH pAb (ATL-HPA041370 w/enhanced validation) |
| Citations for Anti FAH pAb (ATL-HPA041370 w/enhanced validation) – 2 Found |
| Nguyen, Tran N; Nguyen, Ha Q; Le, Duc-Hau. Unveiling prognostics biomarkers of tyrosine metabolism reprogramming in liver cancer by cross-platform gene expression analyses. Plos One. 15(6):e0229276. PubMed |
| Colemonts-Vroninks, Haaike; Neuckermans, Jessie; Marcelis, Lionel; Claes, Paul; Branson, Steven; Casimir, Georges; Goyens, Philippe; Martens, Geert A; Vanhaecke, Tamara; De Kock, Joery. Oxidative Stress, Glutathione Metabolism, and Liver Regeneration Pathways Are Activated in Hereditary Tyrosinemia Type 1 Mice upon Short-Term Nitisinone Discontinuation. Genes. 2020;12(1) PubMed |