Anti FAF1 pAb (ATL-HPA018253)

Atlas Antibodies

SKU: ATL-HPA018253-100

• 
• 

Protein Description: Fas (TNFRSF6) associated factor 1
Gene Name: FAF1
Alternative Gene Name: CGI-03, hFAF1, HFAF1s, UBXD12, UBXN3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010517: 99%, ENSRNOG00000008523: 99%
Entrez Gene ID: 11124
Uniprot ID: Q9UNN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFS
• Gene Sequence: IPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFS
• Gene ID - Mouse: ENSMUSG00000010517
• Gene ID - Rat: ENSRNOG00000008523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.