Anti FAF1 pAb (ATL-HPA018253)

Atlas Antibodies

Catalog No.:
ATL-HPA018253-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: Fas (TNFRSF6) associated factor 1
Gene Name: FAF1
Alternative Gene Name: CGI-03, hFAF1, HFAF1s, UBXD12, UBXN3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010517: 99%, ENSRNOG00000008523: 99%
Entrez Gene ID: 11124
Uniprot ID: Q9UNN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFS
Gene Sequence IPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFS
Gene ID - Mouse ENSMUSG00000010517
Gene ID - Rat ENSRNOG00000008523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAF1 pAb (ATL-HPA018253)
Datasheet Anti FAF1 pAb (ATL-HPA018253) Datasheet (External Link)
Vendor Page Anti FAF1 pAb (ATL-HPA018253) at Atlas Antibodies

Documents & Links for Anti FAF1 pAb (ATL-HPA018253)
Datasheet Anti FAF1 pAb (ATL-HPA018253) Datasheet (External Link)
Vendor Page Anti FAF1 pAb (ATL-HPA018253)