Anti FADS1 pAb (ATL-HPA042705)

Atlas Antibodies

SKU:
ATL-HPA042705-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: fatty acid desaturase 1
Gene Name: FADS1
Alternative Gene Name: D5D, FADS6, FADSD5, LLCDL1, TU12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010663: 96%, ENSRNOG00000020480: 96%
Entrez Gene ID: 3992
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANH
Gene Sequence GSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANH
Gene ID - Mouse ENSMUSG00000010663
Gene ID - Rat ENSRNOG00000020480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FADS1 pAb (ATL-HPA042705)
Datasheet Anti FADS1 pAb (ATL-HPA042705) Datasheet (External Link)
Vendor Page Anti FADS1 pAb (ATL-HPA042705) at Atlas Antibodies

Documents & Links for Anti FADS1 pAb (ATL-HPA042705)
Datasheet Anti FADS1 pAb (ATL-HPA042705) Datasheet (External Link)
Vendor Page Anti FADS1 pAb (ATL-HPA042705)



Citations for Anti FADS1 pAb (ATL-HPA042705) – 1 Found
Lee, Ji-Yoon; Nam, Miso; Son, Hye Young; Hyun, Kwangbeom; Jang, Seo Young; Kim, Jong Woo; Kim, Min Wook; Jung, Youngae; Jang, Eunji; Yoon, Seon-Jin; Kim, Jungeun; Kim, Jihye; Seo, Jinho; Min, Jeong-Ki; Oh, Kyoung-Jin; Han, Baek-Soo; Kim, Won Kon; Bae, Kwang-Hee; Song, Jaewhan; Kim, Jaehoon; Huh, Yong-Min; Hwang, Geum-Sook; Lee, Eun-Woo; Lee, Sang Chul. Polyunsaturated fatty acid biosynthesis pathway determines ferroptosis sensitivity in gastric cancer. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2020;117(51):32433-32442.  PubMed