Anti FADD pAb (ATL-HPA001464 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001464-25
  • Immunohistochemical staining of human gallbladder shows cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
  • Western blot analysis in human cell lines A-431 and HeLa using Anti-FADD antibody. Corresponding FADD RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Fas (TNFRSF6)-associated via death domain
Gene Name: FADD
Alternative Gene Name: GIG3, MORT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031077: 75%, ENSRNOG00000047035: 76%
Entrez Gene ID: 8772
Uniprot ID: Q13158
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN
Gene Sequence LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN
Gene ID - Mouse ENSMUSG00000031077
Gene ID - Rat ENSRNOG00000047035
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FADD pAb (ATL-HPA001464 w/enhanced validation)
Datasheet Anti FADD pAb (ATL-HPA001464 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FADD pAb (ATL-HPA001464 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FADD pAb (ATL-HPA001464 w/enhanced validation)
Datasheet Anti FADD pAb (ATL-HPA001464 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FADD pAb (ATL-HPA001464 w/enhanced validation)



Citations for Anti FADD pAb (ATL-HPA001464 w/enhanced validation) – 1 Found
Marín-Rubio, José L; Vela-Martín, Laura; Fernández-Piqueras, José; Villa-Morales, María. FADD in Cancer: Mechanisms of Altered Expression and Function, and Clinical Implications. Cancers. 2019;11(10)  PubMed